PDB entry 2z7c

View 2z7c on RCSB PDB site
Description: Crystal structure of chromatin protein alba from hyperthermophilic archaeon pyrococcus horikoshii
Class: DNA binding protein,RNA binding protein
Keywords: alba, DNA/RNA binding, Acetylation, Cytoplasm, DNA-binding, RNA-binding, DNA BINDING PROTEIN, RNA BINDING PROTEIN, DNA BINDING PROTEIN,RNA BINDING PROTEIN
Deposited on 2007-08-17, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.23
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA/RNA-binding protein Alba
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PHS053
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z7ca_
  • Chain 'B':
    Compound: DNA/RNA-binding protein Alba
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PHS053
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z7cb_
  • Chain 'C':
    Compound: DNA/RNA-binding protein Alba
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PHS053
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z7cc_
  • Chain 'D':
    Compound: DNA/RNA-binding protein Alba
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PHS053
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z7cd_
  • Heterogens: ARG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z7cA (A:)
    mteehvvyigkkpvmnyvlavitqfhegakevsikargraisravdvaeivrnrflkddv
    dvkeikigteelptadgrttntstieivlarkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z7cA (A:)
    hvvyigkkpvmnyvlavitqfhegakevsikargraisravdvaeivrnrflkddvdvke
    ikigteelptadgrttntstieivlarkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z7cB (B:)
    mteehvvyigkkpvmnyvlavitqfhegakevsikargraisravdvaeivrnrflkddv
    dvkeikigteelptadgrttntstieivlarkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z7cB (B:)
    hvvyigkkpvmnyvlavitqfhegakevsikargraisravdvaeivrnrflkddvdvke
    ikigteelptadgrttntstieivlarkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2z7cC (C:)
    mteehvvyigkkpvmnyvlavitqfhegakevsikargraisravdvaeivrnrflkddv
    dvkeikigteelptadgrttntstieivlarkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z7cC (C:)
    hvvyigkkpvmnyvlavitqfhegakevsikargraisravdvaeivrnrflkddvdvke
    ikigteelptadgrttntstieivlarkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2z7cD (D:)
    mteehvvyigkkpvmnyvlavitqfhegakevsikargraisravdvaeivrnrflkddv
    dvkeikigteelptadgrttntstieivlarkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z7cD (D:)
    teehvvyigkkpvmnyvlavitqfhegakevsikargraisravdvaeivrnrflkddvd
    vkeikigteelptadgrttntstieivlarkt