PDB entry 2z7a

View 2z7a on RCSB PDB site
Description: X-ray crystal structure of RV0760c from Mycobacterium tuberculosis at 2.10 Angstrom resolution
Class: isomerase
Keywords: alpha+beta conical barrel, Structural Genomics, TB Structural Genomics Consortium, TBSGC, Isomerase
Deposited on 2007-08-17, released 2007-09-11
The last revision prior to the SCOP 1.75 freeze date was dated 2008-11-11, with a file datestamp of 2008-11-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative steroid isomerase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0760c, MT0785
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z7aa1
  • Chain 'B':
    Compound: Putative steroid isomerase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0760c, MT0785
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z7ab1
  • Chain 'C':
    Compound: Putative steroid isomerase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0760c, MT0785
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z7ac1
  • Chain 'D':
    Compound: Putative steroid isomerase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0760c, MT0785
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z7ad1
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z7aA (A:)
    mtqttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeav
    gaffdthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkagl
    itnmrgywnldmmtfgnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z7aA (A:)
    ttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaf
    fdthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitn
    mrgywnldmmtfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z7aB (B:)
    mtqttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeav
    gaffdthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkagl
    itnmrgywnldmmtfgnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z7aB (B:)
    qspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaffd
    thiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnmr
    gywnldmmtfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2z7aC (C:)
    mtqttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeav
    gaffdthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkagl
    itnmrgywnldmmtfgnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z7aC (C:)
    qttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavga
    ffdthiaanrltvtceetfpssspdeiahilvlhsefggftsevrgvftyrvnkaglitn
    mrgywnldmmtfg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2z7aD (D:)
    mtqttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeav
    gaffdthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkagl
    itnmrgywnldmmtfgnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z7aD (D:)
    spaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaffdt
    hiaanrltvtceetfpssspdeiahilvlhsefftsevrgvftyrvnkaglitnmrgywn
    ldmmtf