PDB entry 2z77

View 2z77 on RCSB PDB site
Description: X-ray crystal structure of RV0760c from Mycobacterium tuberculosis in complex with estradiol-17beta-hemisuccinate
Class: isomerase
Keywords: alpha+beta conical barrel, complex with estradiol-17beta-hemisuccinate, Structural Genomics, TB Structural Genomics Consortium, TBSGC, Isomerase
Deposited on 2007-08-16, released 2007-09-18
The last revision prior to the SCOP 1.75 freeze date was dated 2008-11-11, with a file datestamp of 2008-11-07.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.207
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative steroid isomerase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0760c, MT0785
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z77a1
  • Chain 'B':
    Compound: Putative steroid isomerase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0760c, MT0785
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z77b1
  • Chain 'C':
    Compound: Putative steroid isomerase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0760c, MT0785
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z77c1
  • Chain 'D':
    Compound: Putative steroid isomerase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0760c, MT0785
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z77d1
  • Heterogens: ACT, HE7, NCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z77A (A:)
    mtqttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeav
    gaffdthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkagl
    itnmrgywnldmmtfgnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z77A (A:)
    qspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaffd
    thiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnmr
    gywnldmmtfgnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z77B (B:)
    mtqttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeav
    gaffdthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkagl
    itnmrgywnldmmtfgnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z77B (B:)
    tqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaff
    dthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnm
    rgywnldmmtf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2z77C (C:)
    mtqttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeav
    gaffdthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkagl
    itnmrgywnldmmtfgnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z77C (C:)
    tqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaff
    dthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnm
    rgywnldmmtfgn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2z77D (D:)
    mtqttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeav
    gaffdthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkagl
    itnmrgywnldmmtfgnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z77D (D:)
    qspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaffd
    thiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnmr
    gywnldmmtf