PDB entry 2z76

View 2z76 on RCSB PDB site
Description: X-ray crystal structure of RV0760c from Mycobacterium tuberculosis at 1.82 Angstrom resolution
Class: isomerase
Keywords: alpha+beta conical barrel, Structural Genomics, TB Structural Genomics Consortium, TBSGC, Isomerase
Deposited on 2007-08-16, released 2007-09-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.204
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative steroid isomerase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0760c, MT0785
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z76a_
  • Chain 'B':
    Compound: Putative steroid isomerase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv0760c, MT0785
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z76b_
  • Heterogens: ACT, LDA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z76A (A:)
    mtqttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeav
    gaffdthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkagl
    itnmrgywnldmmtfgnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z76A (A:)
    qspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaffd
    thiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnmr
    gywnldmmtfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z76B (B:)
    mtqttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeav
    gaffdthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkagl
    itnmrgywnldmmtfgnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z76B (B:)
    qspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaffd
    thiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnmr
    gywnldmmtfg