PDB entry 2z70

View 2z70 on RCSB PDB site
Description: e.coli rnase 1 in complex with d(cgcgatcgcg)
Deposited on 2007-08-09, released 2008-06-24
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.194
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease I
    Species: Escherichia coli [TaxId:562]
    Gene: rna, rnsA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA (5'-d(*dcp*dgp*dcp*dgp*dap*dtp*dcp*dgp*dcp*dg)-3')
    Species: synthetic, synthetic
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2z70A (A:)
lalqakqygdfdryvlalswqtgfcqsqhdrnrnerdecrlqtettnkadfltvhglwpg
lpksvaargvderrwmrfgcatrpipnlpearasrmcsspetglsletaaklsevmpgag
grscleryeyakhgacfgfdpdayfgtmvrlnqeikeseagkfladnygktvsrrdfdaa
fakswgkenvkavkltcqgnpaylteiqisikadainaplsansflpqphpgncgktfvi
dkagy

  • Chain 'B':
    No sequence available.