PDB entry 2z6z

View 2z6z on RCSB PDB site
Description: Crystal structure of a photoswitchable GFP-like protein Dronpa in the bright-state
Class: fluorescent protein
Keywords: GFP-like Protein, photochromism, FLUORESCENT PROTEIN
Deposited on 2007-08-09, released 2008-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z6za_
  • Chain 'B':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z6zb_
  • Chain 'C':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z6zc_
  • Chain 'D':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z6zd_
  • Chain 'E':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z6ze_
  • Chain 'F':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z6zf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z6zA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6zA (A:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahselp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z6zB (B:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6zB (B:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfc
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahselp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2z6zC (C:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6zC (C:)
    msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
    fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
    dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
    kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2z6zD (D:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6zD (D:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2z6zE (E:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6zE (E:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahselp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2z6zF (F:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6zF (F:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahsel