PDB entry 2z6u

View 2z6u on RCSB PDB site
Description: Ternary structure of the Glu119Ala M.HhaI, C5-Cytosine DNA methyltransferase, with unmodified DNA and AdoHcy
Class: transferase/DNA
Keywords: beta-alpha-Complex, Methyltransferase, Restriction system, S-adenosyl-L-methionine, Transferase, TRANSFERASE/DNA COMPLEX
Deposited on 2007-08-09, released 2007-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.212
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: modification methylase hhai
  Species: Haemophilus parahaemolyticus [TaxId:735]
  Gene: hhaIM
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05102 (0-326)
    • engineered (118)
  Domains in SCOPe 2.08: d2z6ua_
• Chain 'C':
  Compound: DNA (5'-d(*dgp*dap*dtp*dap*dgp*dcp*dgp*dcp*dtp*dap*dtp*dc)-3')
  Species: synthetic, synthetic
  
• Chain 'D':
  Compound: DNA (5'-d(*dtp*dgp*dap*dtp*dap*dgp*dcp*dgp*dcp*dtp*dap*dtp*dc)-3')
  Species: synthetic, synthetic
  
• Heterogens: SAH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2z6uA (A:)
  mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
  itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfman
  vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
  qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
  iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
  qfgnsvvinvlqyiaynigsslnfkpy
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.