PDB entry 2z6q

View 2z6q on RCSB PDB site
Description: Ternary structure of Arg165Ala M.HhaI C5-Cytosine DNA methyltransferase with unmodified DNA and AdoHcy
Class: transferase/DNA
Keywords: beta-alpha-complex, Methyltransferase, Restriction system, S-adenosyl-L-methionine, Transferase, TRANSFERASE-DNA COMPLEX
Deposited on 2007-08-08, released 2007-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-17, with a file datestamp of 2021-02-12.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: modification methylase hhai
  Species: Haemophilus parahaemolyticus [TaxId:735]
  Gene: hhaIM
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05102 (0-326)
    • engineered (164)
  Domains in SCOPe 2.08: d2z6qa_
• Chain 'C':
  Compound: DNA (5'-d(*dgp*dap*dtp*dap*dgp*dcp*dgp*dcp*dtp*dap*dtp*dc)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'D':
  Compound: DNA (5'-d(*dtp*dgp*dap*dtp*dap*dg)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'E':
  Compound: DNA (5'-d(*dgp*dcp*dtp*dap*dtp*dc)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Heterogens: DCZ, SAH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2z6qA (A:)
  mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
  itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
  vknfashdngntlevvkntmneldysfhakvlnaldygipqkreaiymicfrndlniqnf
  qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
  iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
  qfgnsvvinvlqyiaynigsslnfkpy
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.