PDB entry 2z6p

View 2z6p on RCSB PDB site
Description: Crystal Structure of the Ufc1, Ufm1 conjugating enzyme 1
Class: ligase
Keywords: UFC1, UFM1, UBIQUITIN, UBL, Polymorphism, Ubl conjugation pathway, LIGASE
Deposited on 2007-08-06, released 2007-09-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ufm1-conjugating enzyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UFC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2z6pa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z6pA (A:)
    gplgsmadeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfr
    lesnkegtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggki
    cltdhfkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6pA (A:)
    madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
    egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
    fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhke