PDB entry 2z6f

View 2z6f on RCSB PDB site
Description: Crystal structure of NEAT domain from Staphylococcus aureus in complex with heme
Class: heme binding protein
Keywords: IgG-like fold, Cell wall, Peptidoglycan-anchor, Secreted, HEME BINDING PROTEIN
Deposited on 2007-07-31, released 2008-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-09, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-regulated surface determinant protein H
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: IsdH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z6fa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z6fA (A:)
    gsamaptndqltdlqeahfvvfeseensesvmdgfvehpfytatlngqkyvvmktkddsy
    wkdlivegkrvttvskdpknnsrtlifpyipdkavynaivkvvvanigyegqyhvriinq
    dintkdddtsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z6fA (A:)
    ltdlqeahfvvfeseensesvmdgfvehpfytatlngqkyvvmktkddsywkdlivegkr
    vttvskdpknnsrtlifpyipdkavynaivkvvvanigyegqyhvriinqdi