PDB entry 2z61

View 2z61 on RCSB PDB site
Description: Crystal structure of MJ0684 from Methanococcus jannaschii reveals its similarity in the active site to kynurenine aminotransferases
Class: Transferase
Keywords: amino acid aminotransferase, kynurenine aminotransferase, MJ0684, Cytoplasm, Pyridoxal phosphate
Deposited on 2007-07-21, released 2008-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable aspartate aminotransferase 2
    Species: Methanococcus jannaschii
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z61a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z61A (A:)
    mlskrllnfesfevmdilalaqklesegkkvihleigepdfntpkpivdegikslkegkt
    hytdsrgilelrekiselykdkykadiipdniiitggsslglffalssiiddgdevliqn
    pcypcyknfirflgakpvfcdftvesleealsdktkaiiinspsnplgevidreiyefay
    enipyiisdeiynglvyegkcysaiefdenlektilingfsklyamtgwrigyvisndei
    ieailklqqnlfisaptisqyaalkafeketereinsmikefdrrrrlvlkyvkdfgwev
    nnpigayyvfpnigedgrefaykllkekfvaltpgigfgskgknyirisyansyenikeg
    lerikeflnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z61A (A:)
    mlskrllnfesfevmdilalaqklesegkkvihleigepdfntpkpivdegikslkegkt
    hytdsrgilelrekiselykdkykadiipdniiitggsslglffalssiiddgdevliqn
    pcypcyknfirflgakpvfcdftvesleealsdktkaiiinspsnplgevidreiyefay
    enipyiisdeiynglvyegkcysaiefdenlektilingfsklyamtgwrigyvisndei
    ieailklqqnlfisaptisqyaalkafeketereinsmikefdrrrrlvlkyvkdfgwev
    nnpigayyvfpnigedgrefaykllkekfvaltpgigfgskgknyirisyansyenikeg
    lerikefln