PDB entry 2z60

View 2z60 on RCSB PDB site
Description: Crystal Structure of the T315I Mutant of Abl kinase bound with PPY-A
Class: transferase
Keywords: Abl, kinase, mutant, T315I, Alternative splicing, ATP-binding, Cell adhesion, Chromosomal rearrangement, Cytoplasm, Cytoskeleton, Lipoprotein, Magnesium, Manganese, Metal-binding, Myristate, Nucleotide-binding, Nucleus, Phosphorylation, Proto-oncogene, SH2 domain, SH3 domain, Transferase
Deposited on 2007-07-21, released 2007-09-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.206
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00520 (1-End)
      • expression tag (0)
      • engineered (87)
    Domains in SCOPe 2.04: d2z60a_
  • Heterogens: P3Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z60A (A:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z60A (A:)
    gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkeeveeflkeaavm
    keikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqissa
    meylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapes
    laynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvye
    lmracwqwnpsdrpsfaeihqafetmfqessisdevekelg