PDB entry 2z5u

View 2z5u on RCSB PDB site
Description: Crystal structure of Lysine-specific histone demethylase 1
Class: oxidoreductase
Keywords: chromatin, histone demethylase, nucleosome, transcription, LSD1, Lysine-specific, Chromatin regulator, FAD, Nucleus, Oxidoreductase, Phosphorylation, Repressor, Transcription regulation, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-07-17, released 2008-04-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.225
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific histone demethylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0601, LSD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2z5ua1, d2z5ua2, d2z5ua3
  • Heterogens: FAJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z5uA (A:)
    sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
    eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgkviiigsgvsgl
    aaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavvskqvnm
    elakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgqa
    levviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeasevkpp
    rditaeflvkskhrdltalckeydelaetqgkleeklqeleanppsdvylssrdrqildw
    hfanlefanatplstlslkhwdqdddfeftgshltvrngyscvpvalaegldiklntavr
    qvrytasgceviavntrstsqtfiykcdavlctlplgvlkqqppavqfvpplpewktsav
    qrmgfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvagea
    agimenisddvivgrclailkgifgssavpqpketvvsrwradpwargsysyvaagssgn
    dydlmaqpitpgpsipgapqpiprlffagehtirnypatvhgallsglreagriadqflg
    am
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z5uA (A:)
    sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
    eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgkviiigsgvsgl
    aaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavvskqvnm
    elakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgqa
    levviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeitaeflv
    kskhrdltalckeydelaetqgkleeklqeleanppsdvylssrdrqildwhfanlefan
    atplstlslkhwdqdddfeftgshltvrngyscvpvalaegldiklntavrqvrytasgc
    eviavntrstsqtfiykcdavlctlplgvlkqqppavqfvpplpewktsavqrmgfgnln
    kvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagimenisd
    dvivgrclailkgifgssavpqpketvvsrwradpwargsysyvaagssgndydlmaqpi
    tppiprlffagehtirnypatvhgallsglreagriadqflg