PDB entry 2z5h

View 2z5h on RCSB PDB site
Description: Crystal structure of the head-to-tail junction of tropomyosin complexed with a fragment of TnT
Class: contractile protein
Keywords: coiled coil, actin, troponin, tropomyosin, cytoskeleton, cardiomyopathy, four-helix bundle, CONTRACTILE PROTEIN
Deposited on 2007-07-12, released 2008-04-22
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-22, with a file datestamp of 2008-04-18.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: 0.237
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
  Species: Saccharomyces cerevisiae and Oryctolagus cuniculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (1-20)
    • expression tag (0)
  • Uniprot P58772 (21-End)
  Domains in SCOP 1.75: d2z5ha1
• Chain 'B':
  Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
  Species: Saccharomyces cerevisiae and Oryctolagus cuniculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (1-20)
    • expression tag (0)
  • Uniprot P58772 (21-End)
• Chain 'C':
  Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
  Species: Saccharomyces cerevisiae and Oryctolagus cuniculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (1-20)
    • expression tag (0)
  • Uniprot P58772 (21-51)
• Chain 'D':
  Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
  Species: Saccharomyces cerevisiae and Oryctolagus cuniculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (1-20)
    • expression tag (0)
  • Uniprot P58772 (21-End)
• Chain 'E':
  Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
  Species: Saccharomyces cerevisiae and Oryctolagus cuniculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (1-20)
    • expression tag (0)
  • Uniprot P58772 (21-End)
• Chain 'F':
  Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
  Species: Saccharomyces cerevisiae and Oryctolagus cuniculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (1-20)
    • expression tag (0)
  • Uniprot P58772 (21-End)
• Chain 'G':
  Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
  Species: Saccharomyces cerevisiae and Oryctolagus cuniculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (1-20)
    • expression tag (0)
  • Uniprot P58772 (21-51)
• Chain 'H':
  Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
  Species: Saccharomyces cerevisiae and Oryctolagus cuniculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (1-20)
    • expression tag (0)
  • Uniprot P58772 (21-End)
• Chain 'I':
  Compound: Tropomyosin alpha-1 chain and General control protein GCN4
  Species: Oryctolagus cuniculus and Saccharomyces cerevisiae
  Database cross-references and differences (RAF-indexed):
  • Uniprot P58772 (4-27)
    • expression tag (0-3)
  • Uniprot P03069 (28-End)
• Chain 'T':
  Compound: Troponin T, fast skeletal muscle isoforms
  Species: GALLUS GALLUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12620
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2z5hA (A:)
  gellsknyhlenevarlkklvddledelyaqklkykaiseeldhalndmtsi
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2z5hA (A:)
  gellsknyhlenevarlkklvddledelyaqklkykaiseeldhalndm
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'T':
  No sequence available.