PDB entry 2z5h

View 2z5h on RCSB PDB site
Description: Crystal structure of the head-to-tail junction of tropomyosin complexed with a fragment of TnT
Class: contractile protein
Keywords: actin, troponin, tropomyosin, cytoskeleton, cardiomyopathy, four-helix bundle, CONTRACTILE PROTEIN
Deposited on 2007-07-12, released 2008-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
    Species: , [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (1-20)
      • expression tag (0)
    • Uniprot P58772 (21-End)
    Domains in SCOPe 2.08: d2z5ha1, d2z5ha2
  • Chain 'B':
    Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
    Species: , [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (1-20)
      • expression tag (0)
    • Uniprot P58772 (21-End)
  • Chain 'C':
    Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
    Species: , [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (1-20)
      • expression tag (0)
    • Uniprot P58772 (21-51)
  • Chain 'D':
    Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
    Species: , [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (1-20)
      • expression tag (0)
    • Uniprot P58772 (21-End)
  • Chain 'E':
    Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
    Species: , [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (1-20)
      • expression tag (0)
    • Uniprot P58772 (21-End)
  • Chain 'F':
    Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
    Species: , [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (1-20)
      • expression tag (0)
    • Uniprot P58772 (21-End)
  • Chain 'G':
    Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
    Species: , [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (1-20)
      • expression tag (0)
    • Uniprot P58772 (21-51)
  • Chain 'H':
    Compound: General control protein GCN4 and Tropomyosin alpha-1 chain
    Species: , [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (1-20)
      • expression tag (0)
    • Uniprot P58772 (21-End)
  • Chain 'I':
    Compound: Tropomyosin alpha-1 chain and General control protein GCN4
    Species: , [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58772 (4-27)
      • expression tag (0-3)
    • Uniprot P03069 (28-End)
  • Chain 'T':
    Compound: Troponin T, fast skeletal muscle isoforms
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z5hA (A:)
    gellsknyhlenevarlkklvddledelyaqklkykaiseeldhalndmtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z5hA (A:)
    gellsknyhlenevarlkklvddledelyaqklkykaiseeldhalndm
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'T':
    No sequence available.