PDB entry 2z5f

View 2z5f on RCSB PDB site
Description: Human sulfotransferase Sult1b1 in complex with PAP
Class: transferase
Keywords: SULT, SULFOTRANSFERASE, PAP, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2007-07-07, released 2007-08-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfotransferase family cytosolic 1B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT1B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z5fa_
  • Chain 'B':
    Compound: Sulfotransferase family cytosolic 1B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT1B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z5fb_
  • Heterogens: A3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z5fA (A:)
    gsmlspkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseii
    dmilndgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpks
    fwennckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvk
    nwwkrkeehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnpl
    vnythlpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z5fA (A:)
    pkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseiidmiln
    dgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpksfwenn
    ckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvknwwkr
    keehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnplvnyth
    lpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z5fB (B:)
    gsmlspkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseii
    dmilndgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpks
    fwennckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvk
    nwwkrkeehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnpl
    vnythlpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z5fB (B:)
    pkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseiidmiln
    dgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpksfwenn
    ckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvknwwkr
    keehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnplvnyth
    lpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei