PDB entry 2z5e

View 2z5e on RCSB PDB site
Description: Crystal Structure of Proteasome Assembling Chaperone 3
Deposited on 2007-07-06, released 2008-02-19
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome Assembling Chaperone 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Proteasome Assembling Chaperone 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2z5eA (A:)
    medtplviskqktevvcgvptqvvctafsshilvvvtqfgkmgtlvslepssvasdvskp
    vlttkvllgqdeplihvfaknlvafvsqeagnravllavavkdksmeglkalrevirvcq
    vw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2z5eB (B:)
    medtplviskqktevvcgvptqvvctafsshilvvvtqfgkmgtlvslepssvasdvskp
    vlttkvllgqdeplihvfaknlvafvsqeagnravllavavkdksmeglkalrevirvcq
    vw