PDB entry 2z5d

View 2z5d on RCSB PDB site
Description: Human ubiquitin-conjugating enzyme E2 H
Class: ligase
Keywords: UBIQUITIN, UBIQUITIN-CONJUGATING ENZYME, UBE2H, SGC, LIGASE, Structural Genomics, Structural Genomics Consortium
Deposited on 2007-07-06, released 2007-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.184
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 H
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2H
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62256
      • see remark 999 (34)
    Domains in SCOPe 2.06: d2z5da1
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 H
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2H
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62256
      • see remark 999 (34)
    Domains in SCOPe 2.06: d2z5db_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z5dA (A:)
    mgsshhhhhhssglvprgsmsspspgkrrmdtdviklieskhevtilgglnefvvkfygp
    qgtpyeggvwkvrvdlpdkypfkspsigfmnkifhpnideasgtvcldvinqtwtalydl
    tnifesflpqllaypnpidplngdaaamylhrpeeykqkikeyiqkyateealkeqeeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z5dA (A:)
    pspgkrrmdtdviklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypf
    kspsigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidpln
    gdaaamylhrpeeykqkikeyiqkyateealk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z5dB (B:)
    mgsshhhhhhssglvprgsmsspspgkrrmdtdviklieskhevtilgglnefvvkfygp
    qgtpyeggvwkvrvdlpdkypfkspsigfmnkifhpnideasgtvcldvinqtwtalydl
    tnifesflpqllaypnpidplngdaaamylhrpeeykqkikeyiqkyateealkeqeeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z5dB (B:)
    pgkrrmdtdviklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypfks
    psigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidplngd
    aaamylhrpeeykqkikeyiqkyateealke