PDB entry 2z54

View 2z54 on RCSB PDB site
Description: The Influence of I47A Mutation on Reduced Susceptibility to the Protease Inhibitor Lopinavir
Class: hydrolase
Keywords: Complex (Aspartic Protease/Inhibitor), Aspartic Protease, Resistant Strain, HYDROLASE
Deposited on 2007-06-28, released 2008-07-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.202
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1 [TaxId:11682]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • engineered (46)
    • conflict (53)
  Domains in SCOPe 2.02: d2z54a_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1 [TaxId:11682]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • engineered (46)
    • conflict (53)
  Domains in SCOPe 2.02: d2z54b_
• Heterogens: BME, AB1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2z54A (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmaggiggfvkvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2z54B (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmaggiggfvkvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf