PDB entry 2z4b

View 2z4b on RCSB PDB site
Description: Estrogen receptor beta ligand-binding domain complexed to a benzopyran ligand
Class: transcription
Keywords: nuclear receptor ligand binding domain, TRANSCRIPTION
Deposited on 2007-06-14, released 2007-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.232
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z4ba_
  • Chain 'B':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z4bb_
  • Heterogens: DC8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z4bA (A:)
    mhhhhhhrellldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvh
    miswakkipgfvelslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegk
    cvegileifdmllattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklah
    llnavtdalvwviaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvy
    dlllemlnahvlrgcks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z4bA (A:)
    dalspeqlvltlleaepphvlisrpasmmmsltkladkelvhmiswakkipgfvelslfd
    qvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllattsr
    frelklqhkeylcvkamillnssmyplvssrklahllnavtdalvwviaksgissqqqsm
    rlanllmllshvrhasnkgmehllnmkvpvydlllemlnah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z4bB (B:)
    mhhhhhhrellldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvh
    miswakkipgfvelslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegk
    cvegileifdmllattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklah
    llnavtdalvwviaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvy
    dlllemlnahvlrgcks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z4bB (B:)
    ldalspeqlvltlleaepphvlisrpasmmmsltkladkelvhmiswakkipgfvelslf
    dqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllatts
    rfrelklqhkeylcvkamillnssmyplvssrklahllnavtdalvwviaksgissqqqs
    mrlanllmllshvrhasnkgmehllnmkvpvydlllemlnahvl