PDB entry 2z47

View 2z47 on RCSB PDB site
Description: The Y66L mutant of tetraheme cytochrome c3 from Desulfovibrio Vulgaris Miyazaki F
Class: electron transport
Keywords: ELECTRON TRANSPORT, Heme, Iron, Metal-binding, Periplasmic, Sulfate respiration, Transport
Deposited on 2007-06-13, released 2008-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.184
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00132
      • engineered (65)
    Domains in SCOPe 2.07: d2z47a_
  • Chain 'B':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00132 (0-106)
      • engineered (65)
    Domains in SCOPe 2.07: d2z47b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z47A (A:)
    apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkedyqkcatagchdnmdkkdk
    sakgylhamhdkgtkfkscvgchletagadaakkkeltgckgskchs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z47B (B:)
    apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkedyqkcatagchdnmdkkdk
    sakgylhamhdkgtkfkscvgchletagadaakkkeltgckgskchs