PDB entry 2z42

View 2z42 on RCSB PDB site
Description: Crystal Structure of Family 7 Alginate Lyase A1-II' from Sphingomonas sp. A1
Class: lyase
Keywords: alginate lyase, polysaccharide lyase family 7, LYASE
Deposited on 2007-06-12, released 2008-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alginate lyase
    Species: Sphingomonas sp. [TaxId:28214]
    Gene: ALY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q75WP3 (1-228)
      • expression tag (229-233)
    Domains in SCOPe 2.07: d2z42a1, d2z42a2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z42A (A:)
    mpaaapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggtt
    anssyprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqihgimddgtn
    applvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngd
    trsvdfvgkdagwknlkyyfkagnyvqdntstggsaiaklyslsvshsnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z42A (A:)
    paaapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggtta
    nssyprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqihgimddgtna
    pplvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdt
    rsvdfvgkdagwknlkyyfkagnyvqdntstggsaiaklyslsvshsnlehhh