PDB entry 2z3y

View 2z3y on RCSB PDB site
Description: Crystal structure of Lysine-specific demethylase1
Class: oxidoreductase
Keywords: chromatin, crystal structure, histone demethylase, nucleosome, transcription, LSD1, Lysine-specific, Alternative splicing, Chromatin regulator, Coiled coil, FAD, Nucleus, Oxidoreductase, Phosphorylation, Repressor, Transcription regulation, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-06-08, released 2008-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.218
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific histone demethylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0601, LSD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z3ya1, d2z3ya2, d2z3ya3
  • Heterogens: F2N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z3yA (A:)
    sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
    eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgkviiigsgvsgl
    aaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavvskqvnm
    elakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgqa
    levviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeasevkpp
    rditaeflvkskhrdltalckeydelaetqgkleeklqeleanppsdvylssrdrqildw
    hfanlefanatplstlslkhwdqdddfeftgshltvrngyscvpvalaegldiklntavr
    qvrytasgceviavntrstsqtfiykcdavlctlplgvlkqqppavqfvpplpewktsav
    qrmgfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvagea
    agimenisddvivgrclailkgifgssavpqpketvvsrwradpwargsysyvaagssgn
    dydlmaqpitpgpsipgapqpiprlffagehtirnypatvhgallsglreagriadqflg
    am
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3yA (A:)
    sgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
    eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgkviiigsgvsgl
    aaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavvskqvnm
    elakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgqa
    levviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeditaefl
    vkskhrdltalckeydelaetqgkleeklqeleanppsdvylssrdrqildwhfanlefa
    natplstlslkhwdqdddfeftgshltvrngyscvpvalaegldiklntavrqvrytasg
    ceviavntrstsqtfiykcdavlctlplgvlkqqppavqfvpplpewktsavqrmgfgnl
    nkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagimenis
    ddvivgrclailkgifgssavpqpketvvsrwradpwargsysyvaagssgndydlmaqp
    itppiprlffagehtirnypatvhgallsglreagriadqflg