PDB entry 2z3b

View 2z3b on RCSB PDB site
Description: Crystal Structure of Bacillus Subtilis CodW, a non-canonical HslV-like peptidase with an impaired catalytic apparatus
Class: hydrolase
Keywords: N-terminal nucleophile hydrolase
Deposited on 2007-06-03, released 2008-03-25
The last revision prior to the SCOP 1.75 freeze date was dated 2008-03-25, with a file datestamp of 2008-03-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis
    Gene: CODW
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z3ba1
  • Chain 'B':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis
    Gene: CODW
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z3bb1
  • Chain 'C':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis
    Gene: CODW
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z3bc1
  • Chain 'D':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis
    Gene: CODW
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z3bd1
  • Chain 'E':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis
    Gene: CODW
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z3be1
  • Chain 'F':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis
    Gene: CODW
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z3bf1
  • Chain 'G':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis
    Gene: CODW
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z3bg1
  • Chain 'H':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis
    Gene: CODW
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z3bh1
  • Chain 'I':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis
    Gene: CODW
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z3bi1
  • Chain 'J':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis
    Gene: CODW
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z3bj1
  • Chain 'K':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis
    Gene: CODW
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z3bk1
  • Chain 'L':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis
    Gene: CODW
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z3bl1
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3bA (A:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3bB (B:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3bC (C:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3bD (D:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3bE (E:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3bF (F:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3bG (G:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3bH (H:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3bI (I:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3bJ (J:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3bK (K:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3bL (L:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele