PDB entry 2z3a

View 2z3a on RCSB PDB site
Description: Crystal Structure of Bacillus Subtilis CodW, a non-canonical HslV-like peptidase with an impaired catalytic apparatus
Class: hydrolase
Keywords: ATP-dependent protease, NTN-hydrolase
Deposited on 2007-06-03, released 2008-03-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.245
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z3aa1
  • Chain 'B':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z3ab1
  • Chain 'C':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z3ac1
  • Chain 'D':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z3ad1
  • Chain 'E':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z3ae1
  • Chain 'F':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z3af1
  • Chain 'G':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z3ag1
  • Chain 'H':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z3ah1
  • Chain 'I':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z3ai1
  • Chain 'J':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z3aj1
  • Chain 'K':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z3ak1
  • Chain 'L':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z3al1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3aA (A:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3aB (B:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3aC (C:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3aD (D:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3aE (E:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3aF (F:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3aG (G:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3aH (H:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3aI (I:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3aJ (J:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3aK (K:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3aL (L:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele