PDB entry 2z36

View 2z36 on RCSB PDB site
Description: Crystal structure of cytochrome P450 MoxA from Nonomuraea recticatena (CYP105)
Class: oxidoreductase
Keywords: p450, cyp105, oxidoreductase
Deposited on 2007-06-02, released 2007-08-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.23
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 type compactin 3'',4''-hydroxylase
    Species: Nonomuraea recticatena [TaxId:46178]
    Gene: moxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2L6S8 (Start-406)
      • expression tag (407-411)
    Domains in SCOPe 2.03: d2z36a_
  • Chain 'B':
    Compound: Cytochrome P450 type compactin 3'',4''-hydroxylase
    Species: Nonomuraea recticatena [TaxId:46178]
    Gene: moxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2L6S8 (Start-406)
      • expression tag (407-411)
    Domains in SCOPe 2.03: d2z36b_
  • Heterogens: FE, HEM, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z36A (A:)
    mtknvadelaglelpvergcpfappaayerlrerapinkvrltsggqawwvsgheearav
    ladgrfssdkrkdgfplftldaatlqqlrsqpplmlgmdgaehsaarrpvigeftvkrla
    alrpriqdivdhfiddmlatdqrpvdlvqalslpvpslvicellgvpytdhdffqsrttm
    mvsrtsmedrrrafaelrayiddlitrkesepgddlfsrqiarqrqegtldhaglvslaf
    llltaghettanmislgvvgllshpeqltvvkanpgrtpmaveellryftiadgvtsrla
    tedveiggvsikagegvivsmlsanwdpavfkdpavldvergarhhlafgfgphqclgqn
    larmelqivfdtlfrripslrlavpmedvpfkgdsviygvhelpvtwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z36A (A:)
    aglelpvergcpfappaayerlrerapinkvrltsggqawwvsgheearavladgrfssd
    krkdgfplftldaatlqqlrsqpplmlgmdgaehsaarrpvigeftvkrlaalrpriqdi
    vdhfiddmlatdqrpvdlvqalslpvpslvicellgvpytdhdffqsrttmmvsrtsmed
    rrrafaelrayiddlitrkesepgddlfsrqiarqrqegtldhaglvslafllltaghet
    tanmislgvvgllshpeqltvvkanpgrtpmaveellryftiadgvtsrlatedveiggv
    sikagegvivsmlsanwdpavfkdpavldvergarhhlafgfgphqclgqnlarmelqiv
    fdtlfrripslrlavpmedvpfkgdsviygvhelpvtwhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z36B (B:)
    mtknvadelaglelpvergcpfappaayerlrerapinkvrltsggqawwvsgheearav
    ladgrfssdkrkdgfplftldaatlqqlrsqpplmlgmdgaehsaarrpvigeftvkrla
    alrpriqdivdhfiddmlatdqrpvdlvqalslpvpslvicellgvpytdhdffqsrttm
    mvsrtsmedrrrafaelrayiddlitrkesepgddlfsrqiarqrqegtldhaglvslaf
    llltaghettanmislgvvgllshpeqltvvkanpgrtpmaveellryftiadgvtsrla
    tedveiggvsikagegvivsmlsanwdpavfkdpavldvergarhhlafgfgphqclgqn
    larmelqivfdtlfrripslrlavpmedvpfkgdsviygvhelpvtwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z36B (B:)
    laglelpvergcpfappaayerlrerapinkvrltsggqawwvsgheearavladgrfss
    dkrkdgfplftldaatlqqlrsqpplmlgmdgaehsaarrpvigeftvkrlaalrpriqd
    ivdhfiddmlatdqrpvdlvqalslpvpslvicellgvpytdhdffqsrttmmvsrtsme
    drrrafaelrayiddlitrkesepgddlfsrqiarqrqegtldhaglvslafllltaghe
    ttanmislgvvgllshpeqltvvkanpgrtpmaveellryftiadgvtsrlatedveigg
    vsikagegvivsmlsanwdpavfkdpavldvergarhhlafgfgphqclgqnlarmelqi
    vfdtlfrripslrlavpmedvpfkgdsviygvhelpvtwhhhhh