PDB entry 2z33

View 2z33 on RCSB PDB site
Description: Solution structure of the DNA complex of PhoB DNA-binding/transactivation Domain
Class: transcription/DNA
Keywords: winged helix-turn-helix, transcription/DNA complex
Deposited on 2007-05-31, released 2008-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphate regulon transcriptional regulatory protein phob
    Species: Escherichia coli [TaxId:562]
    Gene: phoB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2z33a_
  • Chain 'B':
    Compound: 5'-d(*ap*cp*tp*gp*tp*cp*ap*tp*ap*ap*ap*tp*cp*tp*gp*t)-3'
  • Chain 'C':
    Compound: 5'-d(*ap*cp*ap*gp*ap*tp*tp*tp*ap*tp*gp*ap*cp*ap*gp*t)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z33A (A:)
    maveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwg
    tnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.