PDB entry 2z32

View 2z32 on RCSB PDB site
Description: Crystal structure of Keap1 complexed with Prothymosin alpha
Class: transcription
Keywords: Kelch domain, b-propellor domain, Nrf2 regulation, Prothymosin-a interactor, Cytoplasm, Kelch repeat, Nucleus, Transcription, Transcription regulation, Ubl conjugation, Acetylation, Phosphorylation, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-31, released 2008-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Keap1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z32a_
  • Chain 'B':
    Compound: Prothymosin alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z32A (A:)
    mtlhkptqavpcrapkvgrliytaggyfrqslsyleaynpsngswlrladlqvprsglag
    cvvggllyavggrnnspdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiya
    vggshgcihhssveryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsa
    ecyypernewrmitpmntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfv
    apmrhhrsalgitvhqgkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgva
    vtmepcrkqidqqnctcy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z32A (A:)
    vgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns
    pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssvery
    eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpm
    ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhq
    gkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepc
    

  • Chain 'B':
    No sequence available.