PDB entry 2z31

View 2z31 on RCSB PDB site
Description: Crystal structure of immune receptor complex
Class: immune system
Keywords: IMMUNE SYSTEM, complex
Deposited on 2007-05-30, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.235
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell receptor alpha-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z31a_
  • Chain 'B':
    Compound: T-cell receptor beta-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z31b_
  • Chain 'C':
    Compound: H-2 class II histocompatibility antigen, A-U alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14438 (3-180)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d2z31c1, d2z31c2, d2z31c3
  • Chain 'D':
    Compound: H-2 class II histocompatibility antigen, A-U beta chain precursor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z31d1, d2z31d2
  • Chain 'P':
    Compound: Myelin basic protein (MBP)-peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z31 (0-10)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z31A (A:)
    dsvtqtggqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
    featynkeatsfhlqkasvqesdsavyycalsenygnekitfgagtklqvvp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z31B (B:)
    avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghglrliyysygagstekgdipd
    gykasrpsqenfsltlesatpsqtsvyfcasgdasggntlyfgagtrlsvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z31C (C:)
    ieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgg
    lqniatgkhnlgvltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvadgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhwe
    p
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2z31D (D:)
    gdserhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaey
    ynkqylertraeldtvcrynyeetevptslrrleqpnvvislsrtealnhhntlvcsvtd
    fypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslk
    spitvewra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z31D (D:)
    dserhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaeyy
    nkqylertraeldtvcrynyeetevptslrrleqpnvvislsrtealnhhntlvcsvtdf
    ypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslks
    pitvewra
    

  • Chain 'P':
    No sequence available.