PDB entry 2z2e

View 2z2e on RCSB PDB site
Description: Crystal Structure of Canine Milk Lysozyme Stabilized against Non-enzymatic Deamidation
Class: hydrolase
Keywords: LYSOZYME C, Milk Lysozyme, 1,4-BETA-N-Acetylmuramidase C, Bacteriolytic enzyme, HYDROLASE
Deposited on 2007-05-21, released 2007-11-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.28
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C, milk isozyme
    Species: Canis lupus [TaxId:9615]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81708 (0-128)
      • engineered (43)
      • engineered (46)
      • engineered (48)
      • engineered (67)
      • engineered (102)
    Domains in SCOPe 2.01: d2z2ea_
  • Chain 'B':
    Compound: Lysozyme C, milk isozyme
    Species: Canis lupus [TaxId:9615]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81708 (0-128)
      • engineered (43)
      • engineered (46)
      • engineered (48)
      • engineered (67)
      • engineered (102)
    Domains in SCOPe 2.01: d2z2eb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z2eA (A:)
    kifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafqgrqsqgssdygifqln
    skwwcksqshssanacnimcskflddnidddiacakrvvkdpqgmsawvawvkhckgkdl
    skylascnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z2eB (B:)
    kifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafqgrqsqgssdygifqln
    skwwcksqshssanacnimcskflddnidddiacakrvvkdpqgmsawvawvkhckgkdl
    skylascnl