PDB entry 2z2d

View 2z2d on RCSB PDB site
Description: Solution structure of human macrophage elastase (MMP-12) catalytic domain complexed with a gamma-keto butanoic acid inhibitor
Class: hydrolase
Keywords: human macrophage elastase,complex, solution structure, HYDROLASE
Deposited on 2007-05-18, released 2007-11-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2z2da1
  • Heterogens: ZN, CA, HSI

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z2dA (A:)
    frempggpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadi
    lvvfargahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhe
    ighslglghssdpkavmfptykyvdintfrlsaddirgiqslyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z2dA (A:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptykyvdintfrlsaddirgiqslyg