PDB entry 2z21

View 2z21 on RCSB PDB site
Description: Crystal Structure of a five site mutated Cyanovirin-N
Class: sugar binding protein
Keywords: Cyanovirin-N, Sugar binding protein, Anti-HIV, gp120
Deposited on 2007-05-17, released 2007-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.167
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Gene: Cyanovirin-N
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (0-100)
      • engineered (2)
      • engineered (6)
      • engineered (22)
      • engineered (50)
      • engineered (92)
      • cloning artifact (101)
    Domains in SCOPe 2.08: d2z21a1, d2z21a2
  • Chain 'B':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Gene: Cyanovirin-N
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (Start-100)
      • engineered (2)
      • engineered (6)
      • engineered (22)
      • engineered (50)
      • engineered (92)
      • cloning artifact (101-102)
    Domains in SCOPe 2.08: d2z21b1, d2z21b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z21A (A:)
    lgnfsqacynsaiqgsvltstcirtnggyntssidlnsvienvdgslkwqgsnfietcrn
    tqlagsselaaecktraqqfvstkinlddhiaaidgtlkyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z21A (A:)
    lgnfsqacynsaiqgsvltstcirtnggyntssidlnsvienvdgslkwqgsnfietcrn
    tqlagsselaaecktraqqfvstkinlddhiaaidgtlkyel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z21B (B:)
    lgnfsqacynsaiqgsvltstcirtnggyntssidlnsvienvdgslkwqgsnfietcrn
    tqlagsselaaecktraqqfvstkinlddhiaaidgtlkyelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z21B (B:)
    gnfsqacynsaiqgsvltstcirtnggyntssidlnsvienvdgslkwqgsnfietcrnt
    qlagsselaaecktraqqfvstkinlddhiaaidgtlkyele