PDB entry 2z20

View 2z20 on RCSB PDB site
Description: Crystal structure of LL-Diaminopimelate Aminotransferase from Arabidopsis thaliana
Class: transferase
Keywords: LL-diaminopimelate aminotransferase, LL-DAP-AT, PLP, Arabidopsis thaliana, lysine biosynthesis, THDPA, LL-DAP, TRANSFERASE
Deposited on 2007-05-17, released 2007-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.184
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LL-diaminopimelate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g33680
    Database cross-references and differences (RAF-indexed):
    • Uniprot O81885 (Start-425)
      • expression tag (426-429)
    Domains in SCOPe 2.07: d2z20a1, d2z20a2
  • Chain 'B':
    Compound: LL-diaminopimelate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g33680
    Database cross-references and differences (RAF-indexed):
    • Uniprot O81885 (Start-425)
      • expression tag (426)
    Domains in SCOPe 2.07: d2z20b1, d2z20b2
  • Heterogens: SO4, PLP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z20A (A:)
    makrvntckcvatpqekieyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvis
    lgigdttepipevitsamakkahelstiegysgygaeqgakplraaiaktfygglgigdd
    dvfvsdgakcdisrlqvmfgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygniey
    mrctpengffpdlstvgrtdiiffcspnnptgaaatreqltqlvefakkngsiivydsay
    amymsddnprsifeipgaeevametasfskyagftgvrlgwtvipkkllysdgfpvakdf
    nriictcfngasnisqagalacltpegleamhkvigfykentniiidtftslgydvyggk
    napyvwvhfpnqsswdvfaeilekthvvttpgsgfgpggegfvrvsafghrenileacrr
    fkqlykhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z20A (A:)
    eyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvislgigdttepipevitsam
    akkahelstiegysgygaeqgakplraaiaktfygglgigdddvfvsdgakcdisrlqvm
    fgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygnieymrctpengffpdlstvgr
    tdiiffcspnnptgaaatreqltqlvefakkngsiivydsayamymsddnprsifeipga
    eevametasfskyagftgvrlgwtvipkkllysdgfpvakdfnriictcfngasnisqag
    alacltpegleamhkvigfykentniiidtftslgydvyggknapyvwvhfpnqsswdvf
    aeilekthvvttpgsgfgpggegfvrvsafghrenileacrrfkqlykhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z20B (B:)
    makrvntckcvatpqekieyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvis
    lgigdttepipevitsamakkahelstiegysgygaeqgakplraaiaktfygglgigdd
    dvfvsdgakcdisrlqvmfgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygniey
    mrctpengffpdlstvgrtdiiffcspnnptgaaatreqltqlvefakkngsiivydsay
    amymsddnprsifeipgaeevametasfskyagftgvrlgwtvipkkllysdgfpvakdf
    nriictcfngasnisqagalacltpegleamhkvigfykentniiidtftslgydvyggk
    napyvwvhfpnqsswdvfaeilekthvvttpgsgfgpggegfvrvsafghrenileacrr
    fkqlykhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z20B (B:)
    eyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvislgigdttepipevitsam
    akkahelstiegysgygaeqgakplraaiaktfygglgigdddvfvsdgakcdisrlqvm
    fgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygnieymrctpengffpdlstvgr
    tdiiffcspnnptgaaatreqltqlvefakkngsiivydsayamymsddnprsifeipga
    eevametasfskyagftgvrlgwtvipkkllysdgfpvakdfnriictcfngasnisqag
    alacltpegleamhkvigfykentniiidtftslgydvyggknapyvwvhfpnqsswdvf
    aeilekthvvttpgsgfgpggegfvrvsafghrenileacrrfkqlykh