PDB entry 2z1o

View 2z1o on RCSB PDB site
Description: Crystal structure of a photoswitchable GFP-like protein Dronpa in the bright-state
Class: fluorescent protein
Keywords: GFP-like Protein, photochromism, FLUORESCENT PROTEIN
Deposited on 2007-05-10, released 2008-05-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.168
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z1oa_
  • Chain 'B':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z1ob_
  • Chain 'C':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z1oc_
  • Chain 'D':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2z1od_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z1oA (A:)
    gshmsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydil
    ttvfcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiye
    irfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfktty
    kakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z1oA (A:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z1oB (B:)
    gshmsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydil
    ttvfcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiye
    irfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfktty
    kakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z1oB (B:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2z1oC (C:)
    gshmsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydil
    ttvfcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiye
    irfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfktty
    kakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z1oC (C:)
    msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
    fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
    dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
    kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2z1oD (D:)
    gshmsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydil
    ttvfcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiye
    irfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfktty
    kakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z1oD (D:)
    msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
    fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
    dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
    kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahs