PDB entry 2z14

View 2z14 on RCSB PDB site
Description: Crystal structure of the N-terminal DUF1126 in human ef-hand domain containing 2 protein
Deposited on 2007-05-08, released 2007-11-13
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.19
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EF-hand domain-containing family member C2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5JST6 (7-End)
      • expression tag (5-6)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2z14A (A:)
gssgssgwvafdkqvlsfdayleeevldksqtnyriryykiyfypeddtiqvnepevkns
gllqgtsirrhritlpppdedqfytvyhfnvgtevvfygrtfkiydcdaftrnflrkigv
kvnppvqsgpssg

    Sequence, based on observed residues (ATOM records):
    >2z14A (A:)
sgwvafdkqvlsfdayleeevldksqtnyriryykiyfypeddtiqvnepellqgtsirr
hritlpppdedqfytvyhfnvgtevvfygrtfkiydcdaftrnflrkigvkvnppv