PDB entry 2z0z

View 2z0z on RCSB PDB site
Description: Crystal structure of putative acetyltransferase
Class: transferase
Keywords: alpha/beta protein, TRANSFERASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-07, released 2007-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative uncharacterized protein TTHA1799
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHD1 (0-193)
  Domains in SCOPe 2.07: d2z0za_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2z0zA (A:)
  mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllge
  pgrvnwailfgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafev
  lraervqfkvdlrnersqralealgavregvlrknrrlpdgafrddvvysvlkeewpgvk
  arlearlygasgnp