PDB entry 2z0y

View 2z0y on RCSB PDB site
Description: Crystal structure of TTHA0657-SAM complex
Class: transferase
Keywords: Trefoil knot, TRANSFERASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-07, released 2007-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.26
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein TTHA0657
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z0ya1, d2z0ya2
  • Chain 'B':
    Compound: Putative uncharacterized protein TTHA0657
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z0yb1
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z0yA (A:)
    mrphrafspgltgvlplretrhlvevlrarvgdrftvfdgerealaevvdlgpplryrvl
    eerrperevgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrr
    lravaleaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalav
    gpeggfaeeevalleargftpvslgrrilraetaalallalctagegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z0yA (A:)
    rafspgltgvlplretrhlvevlrarvgdrftvfdgerealaevvdlgpplryrvleerr
    perevgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrlrav
    aleaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalavgpeg
    gfaeeevalleargftpvslgrrilraetaalallalctagegr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z0yB (B:)
    mrphrafspgltgvlplretrhlvevlrarvgdrftvfdgerealaevvdlgpplryrvl
    eerrperevgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrr
    lravaleaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalav
    gpeggfaeeevalleargftpvslgrrilraetaalallalctagegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z0yB (B:)
    lryrvleerrperevgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemg
    egklrrlravaleaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpek
    plalavgpeggfaeeevalleargftpvslgrrilraetaalallalctagegr