PDB entry 2z0x

View 2z0x on RCSB PDB site
Description: Crystal structure of ProX-CysSA complex from T. thermophilus
Class: translation
Keywords: Protein-CysSA complex, TRANSLATION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-07, released 2007-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.158
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein TTHA1699
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2z0xa_
  • Heterogens: 5CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z0xA (A:)
    mslspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekga
    ylflvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedl
    lgypevwaaggtpralfratpkellaltgaqvadlkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z0xA (A:)
    slspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekgay
    lflvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedll
    gypevwaaggtpralfratpkellaltgaqvadlkeg