PDB entry 2z0t

View 2z0t on RCSB PDB site
Description: Crystal structure of hypothetical protein PH0355
Class: RNA binding protein
Keywords: alpha/beta protein, RNA BINDING PROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-07, released 2007-11-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein PH0355
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z0ta_
  • Chain 'B':
    Compound: Putative uncharacterized protein PH0355
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z0tb_
  • Chain 'C':
    Compound: Putative uncharacterized protein PH0355
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z0tc_
  • Chain 'D':
    Compound: Putative uncharacterized protein PH0355
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2z0td_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z0tA (A:)
    mkwemglqeeyielikagkkkiegrlydekrrqikpgdiiifeggklkvkvkgirvyssf
    kemlekegienvlpgvksieegvkvyrqfydeerekkygvvaieiepie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z0tB (B:)
    mkwemglqeeyielikagkkkiegrlydekrrqikpgdiiifeggklkvkvkgirvyssf
    kemlekegienvlpgvksieegvkvyrqfydeerekkygvvaieiepie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z0tB (B:)
    mkwemglqeeyielikagkkkiegrlydekrrqikpgdiiifeggklkvkvkgirvyssf
    kemlekegienvlpgvksieegvkvyrqfydeerekkygvvaieiepi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z0tC (C:)
    mkwemglqeeyielikagkkkiegrlydekrrqikpgdiiifeggklkvkvkgirvyssf
    kemlekegienvlpgvksieegvkvyrqfydeerekkygvvaieiepie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2z0tD (D:)
    mkwemglqeeyielikagkkkiegrlydekrrqikpgdiiifeggklkvkvkgirvyssf
    kemlekegienvlpgvksieegvkvyrqfydeerekkygvvaieiepie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z0tD (D:)
    mkwemglqeeyielikagkkkiegrlydekrrqikpgdiiifeggklkvkvkgirvyssf
    kemlekegienvlpgvksieegvkvyrqfydeerekkygvvaieiepi