PDB entry 2z0s

View 2z0s on RCSB PDB site
Description: Crystal structure of putative exosome complex RNA-binding protein
Class: RNA binding protein
Keywords: alpha/beta protein, Cytoplasm, Exosome, RNA BINDING PROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-07, released 2007-11-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.277
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable exosome complex RNA-binding protein 1
    Species: Aeropyrum pernix [TaxId:56636]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2z0sa1, d2z0sa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z0sA (A:)
    msserqlagrivvpgeplpeeveasppyvidykgvkratvvgllrekgdgggrafvklke
    iyvpqagdvvigliqsvgimnwfvdinspyvavlsvqdflgrpfnpavddmqsllkvgdy
    ikakvvafdktrsplltvqgeglgrivrgkiveispakvprvigrkmsmlktleekteck
    ifvarngrihlecpnedleaiavmaikiideeaytsgltkriikfieeerrirev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z0sA (A:)
    eiyvpqagdvvigliqsvgimnwfvdinspyvavlsvqdflgrpfnpavddmqsllkvgd
    yikakvvafdktrsplltvqgeglgrivrgkiveispakvprvigrkmsmlktleektec
    kifvarngrihlecpnedleaiavmaikiideeaytsgltkriikfieeerrire