PDB entry 2z08

View 2z08 on RCSB PDB site
Description: Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Uncharacterized conserved protein, STRUCTURAL GENOMICS, UNKNOWN FUNCTION, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-07, released 2007-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Universal stress protein family
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SJV7 (0-136)
  Domains in SCOPe 2.08: d2z08a_
• Heterogens: MG, ATP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2z08A (A:)
  mfktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrle
  raegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgs
  qsqrvvaeapcpvllvr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2z08A (A:)
  mfktillaydgseharraaevakaeaeahgarlivvhayeprrrleraegvleearaltg
  vpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsqsqrvvaeapcpvl
  lvr