PDB entry 2z08

View 2z08 on RCSB PDB site
Description: Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Uncharacterized conserved protein, STRUCTURAL GENOMICS, UNKNOWN FUNCTION, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-07, released 2007-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Universal stress protein family
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2z08a_
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z08A (A:)
    mfktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrle
    raegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgs
    qsqrvvaeapcpvllvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z08A (A:)
    mfktillaydgseharraaevakaeaeahgarlivvhayeprrrleraegvleearaltg
    vpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsqsqrvvaeapcpvl
    lvr