PDB entry 2yzt

View 2yzt on RCSB PDB site
Description: crystal structure of uncharacterized conserved protein from thermus thermophilus hb8
Deposited on 2007-05-06, released 2007-11-06
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein TTHA1756
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2yztA (A:)
mrrryrvvverdeegyfvahvpelhahtqaqsfeellrrlqeaiavsleeeraevvgleg
aleieaa