PDB entry 2yz8
View 2yz8 on RCSB PDB site
Description: Crystal structure of the 32th Ig-like domain of human obscurin (KIAA1556)
Class: structural protein
Keywords: obsucurin, KIAA1556, Ig fold, STRUCTURAL PROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on
2007-05-04, released
2008-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Obscurin
Species: Homo sapiens [TaxId:9606]
Gene: OBSCN, KIAA1556
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2yz8a_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2yz8A (A:)
gssgssgpvrfqealkdlevleggaatlrcvlssvaapvkwcygnnvlrpgdkyslrqeg
amlelvvrnlrpqdsgryscsfgdqttsatltvtalpsgpssg
Sequence, based on observed residues (ATOM records): (download)
>2yz8A (A:)
pvrfqealkdlevleggaatlrcvlssvaapvkwcygnnvlrpgdkyslrqegamlelvv
rnlrpqdsgryscsfgdqttsatltvtalp