PDB entry 2yz8

View 2yz8 on RCSB PDB site
Description: Crystal structure of the 32th Ig-like domain of human obscurin (KIAA1556)
Class: structural protein
Keywords: obsucurin, KIAA1556, Ig fold, STRUCTURAL PROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-04, released 2008-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Obscurin
  Species: Homo sapiens [TaxId:9606]
  Gene: OBSCN, KIAA1556
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5VST9 (7-96)
  Domains in SCOPe 2.08: d2yz8a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2yz8A (A:)
  gssgssgpvrfqealkdlevleggaatlrcvlssvaapvkwcygnnvlrpgdkyslrqeg
  amlelvvrnlrpqdsgryscsfgdqttsatltvtalpsgpssg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2yz8A (A:)
  pvrfqealkdlevleggaatlrcvlssvaapvkwcygnnvlrpgdkyslrqegamlelvv
  rnlrpqdsgryscsfgdqttsatltvtalp