PDB entry 2yz1

View 2yz1 on RCSB PDB site
Description: Crystal structure of the ligand-binding domain of murine SHPS-1/SIRP alpha
Class: immune system
Keywords: BETA-SANDWICH, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, Alternative splicing, Glycoprotein, Immunoglobulin domain, Membrane, Phosphorylation, Polymorphism, SH3-binding, Transmembrane, IMMUNE SYSTEM
Deposited on 2007-05-02, released 2007-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.176
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type substrate 1
    Species: Mus musculus [TaxId:10090]
    Gene: Shps1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2yz1a_
  • Chain 'B':
    Compound: tyrosine-protein phosphatase non-receptor type substrate 1
    Species: Mus musculus [TaxId:10090]
    Gene: Shps1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2yz1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yz1A (A:)
    gplgskelkvtqpeksvsvaagdstvlnctltsllpvgpikwyrgvgqsrlliysftgeh
    fprvtnvsdatkrnnmdfsirisnvtpedagtyycvkfqkgpsepdteiqsgggtevyvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yz1A (A:)
    elkvtqpeksvsvaagdstvlnctltsllpvgpikwyrgvgqsrlliysftgehfprvtn
    vsdatkrnnmdfsirisnvtpedagtyycvkfqkgpsepdteiqsgggtevyvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yz1B (B:)
    gplgskelkvtqpeksvsvaagdstvlnctltsllpvgpikwyrgvgqsrlliysftgeh
    fprvtnvsdatkrnnmdfsirisnvtpedagtyycvkfqkgpsepdteiqsgggtevyvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yz1B (B:)
    elkvtqpeksvsvaagdstvlnctltsllpvgpikwyrgvgqsrlliysftgehfprvtn
    vsdatkrnnmdfsirisnvtpedagtyycvkfqkgpsepdteiqsgggtevyvl