PDB entry 2yyx

View 2yyx on RCSB PDB site
Description: The Y65A mutant of tetraheme cytochrome c3 from Desulfovibrio Vulgaris Miyazaki F
Class: electron transport
Keywords: electron transport
Deposited on 2007-05-02, released 2008-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.126
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c3
  Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00132 (0-106)
    • engineered (64)
  Domains in SCOPe 2.08: d2yyxa_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yyxA (A:)
  apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkedyqkcatagchdnmdkkdk
  sakgayhamhdkgtkfkscvgchletagadaakkkeltgckgskchs