PDB entry 2yyu

View 2yyu on RCSB PDB site
Description: Crystal structure of uncharacterized conserved protein from Geobacillus kaustophilus
Class: lyase
Keywords: TIM barrel, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE
Deposited on 2007-05-02, released 2007-11-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2yyua_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2yyub_
  • Heterogens: C5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yyuA (A:)
    ghmhtpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfl
    dlklhdipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciav
    tqltstdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasfla
    vtpgirfaddaahdqvrvvtprkaralgsdyivigrsltraadplrtyarlqhewngger
    esttpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yyuA (A:)
    tpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlkl
    hdipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtqlt
    stdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasflavtpg
    irfadrvvtprkaralgsdyivigrsltraadplrtyarlqhewn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yyuB (B:)
    ghmhtpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfl
    dlklhdipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciav
    tqltstdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasfla
    vtpgirfaddaahdqvrvvtprkaralgsdyivigrsltraadplrtyarlqhewngger
    esttpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yyuB (B:)
    htpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlk
    lhdipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtql
    tstdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasflavtp
    girfaddaarvvtprkaralgsdyivigrsltraadplrtyarlqhewn