PDB entry 2yyt

View 2yyt on RCSB PDB site
Description: Crystal structure of uncharacterized conserved protein from Geobacillus kaustophilus
Class: lyase
Keywords: TIM barrel, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE
Deposited on 2007-05-02, released 2007-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yyta_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yytb_
  • Chain 'C':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yytc_
  • Chain 'D':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yytd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yytA (A:)
    ghmhtpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfl
    dlklhdipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciav
    tqltstdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasfla
    vtpgirfaddaahdqvrvvtprkaralgsdyivigrsltraadplrtyarlqhewngger
    esttpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yytA (A:)
    pfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlklh
    dipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtqlts
    tdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasflavtvtp
    rkaralgsdyivigrsltraadplrtyarlqhewn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yytB (B:)
    ghmhtpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfl
    dlklhdipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciav
    tqltstdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasfla
    vtpgirfaddaahdqvrvvtprkaralgsdyivigrsltraadplrtyarlqhewngger
    esttpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yytB (B:)
    pfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlklh
    dipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtqlts
    tdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasflavtvtp
    rkaralgsdyivigrsltraadplrtyarlqhewn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yytC (C:)
    ghmhtpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfl
    dlklhdipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciav
    tqltstdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasfla
    vtpgirfaddaahdqvrvvtprkaralgsdyivigrsltraadplrtyarlqhewngger
    esttpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yytC (C:)
    pfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlklh
    dipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtqlts
    tdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasflavtvtp
    rkaralgsdyivigrsltraadplrtyarlqhewn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yytD (D:)
    ghmhtpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfl
    dlklhdipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciav
    tqltstdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasfla
    vtpgirfaddaahdqvrvvtprkaralgsdyivigrsltraadplrtyarlqhewngger
    esttpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yytD (D:)
    pfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlklh
    dipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtqlts
    tdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasflavtvtp
    rkaralgsdyivigrsltraadplrtyarlqhewn