PDB entry 2yy6

View 2yy6 on RCSB PDB site
Description: Crystal Structure of the phosphoglycolate phosphatase from Aquifex aeolicus VF5
Class: Hydrolase
Keywords: phosphoglycolate phosphatase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Hydrolase
Deposited on 2007-04-27, released 2007-10-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.236
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycolate phosphatase
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2yy6a_
  • Chain 'B':
    Compound: Phosphoglycolate phosphatase
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2yy6b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yy6A (A:)
    mrvilfdldgtlidsakdialalektlkelgleeyypdnvtkyigggvrallekvlkdkf
    reeyvevfrkhylenpvvytkpypeipytlealkskgfklavvsnkleelskkildilnl
    sgyfdlivggdtfgekkpsptpvlktleilgeepekalivgdtdadieagkragtktala
    lwgyvklnsqipdftlsrpsdlvklmdnhivef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yy6A (A:)
    mrvilfdldgtlidsakdialalektlkelgleeyypdnvtkyigggvrallekvlkdkf
    reeyvevfrkhylenpvvytkpypeipytlealkskgfklavvsnkleelskkildilnl
    sgyfdlivggdtfgekkpsptpvlktleilgeepekalivgdtdadieagkragtktala
    lwgyvklnsqipdftlsrpsdlvklmdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yy6B (B:)
    mrvilfdldgtlidsakdialalektlkelgleeyypdnvtkyigggvrallekvlkdkf
    reeyvevfrkhylenpvvytkpypeipytlealkskgfklavvsnkleelskkildilnl
    sgyfdlivggdtfgekkpsptpvlktleilgeepekalivgdtdadieagkragtktala
    lwgyvklnsqipdftlsrpsdlvklmdnhivef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yy6B (B:)
    mrvilfdldgtlidsakdialalektlkelgleeyypdnvtkyigggvrallekvlkdkf
    reeyvevfrkhylenpvvytkpypeipytlealkskgfklavvsnkleelskkildilnl
    sgyfdlivggdtfgekkpsptpvlktleilgeepekalivgdtdadieagkragtktala
    lwgyvklnsqipdftlsrpsdlvklmdn