PDB entry 2yy5

View 2yy5 on RCSB PDB site
Description: Crystal Structure of tryptophanyl-tRNA synthetase from Mycoplasma pneumoniae
Class: ligase
Keywords: Aminoaccyl tRNA synthetase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2007-04-27, released 2008-04-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.192
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Mycoplasma pneumoniae [TaxId:272634]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75510 (Start-347)
      • engineered (241)
    Domains in SCOPe 2.01: d2yy5a_
  • Chain 'B':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Mycoplasma pneumoniae [TaxId:272634]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75510 (2-347)
      • engineered (241)
    Domains in SCOPe 2.01: d2yy5b_
  • Chain 'C':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Mycoplasma pneumoniae [TaxId:272634]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75510 (Start-347)
      • engineered (241)
    Domains in SCOPe 2.01: d2yy5c_
  • Chain 'D':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Mycoplasma pneumoniae [TaxId:272634]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75510 (2-347)
      • engineered (241)
    Domains in SCOPe 2.01: d2yy5d_
  • Heterogens: SO4, WSA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yy5A (A:)
    ghmmkraltgiqasgkqhlgnylgvmqslielqeqcqlfvfvadlhsitvdfqpqalkqn
    nfdlvrtllavgldpqkaclflqsdllehsmmgylmmvqsnlgelqrmtqfkakkaeqtr
    npngtlniptglltypalmagdillyqpdivpvgndqkqhleltrdlaqriqkkfklklr
    lpqfvqnkdtnrimdlfdptkkmskssknqngviylddpkevvvkkirqattdsfnkirf
    asktqpgvtnmltilkallkepvnqsltnqlgndleayfstksyldlknalteatvnllv
    niqrkreqisreqvfnclqagknqaqatarttlalfydgfglgsqnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yy5A (A:)
    mkraltgiqasgkqhlgnylgvmqslielqeqcqlfvfvadlhsitvdfqpqalkqnnfd
    lvrtllavgldpqkaclflqsdllehsmmgylmmvqsnlgelqrmtqfkakkniptgllt
    ypalmagdillyqpdivpvgndqkqhleltrdlaqriqkkfklklrlpqfvqnkdtnrim
    dlfdptkkmskssknqngviylddpkevvvkkirqattdsfnkirfasktqpgvtnmlti
    lkallkepvnqsltnqlgndleayfstksyldlknalteatvnllvniqrkreqisreqv
    fnclqagknqaqatarttlalfydgfglgsqnik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yy5B (B:)
    ghmmkraltgiqasgkqhlgnylgvmqslielqeqcqlfvfvadlhsitvdfqpqalkqn
    nfdlvrtllavgldpqkaclflqsdllehsmmgylmmvqsnlgelqrmtqfkakkaeqtr
    npngtlniptglltypalmagdillyqpdivpvgndqkqhleltrdlaqriqkkfklklr
    lpqfvqnkdtnrimdlfdptkkmskssknqngviylddpkevvvkkirqattdsfnkirf
    asktqpgvtnmltilkallkepvnqsltnqlgndleayfstksyldlknalteatvnllv
    niqrkreqisreqvfnclqagknqaqatarttlalfydgfglgsqnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yy5B (B:)
    mmkraltgiqasgkqhlgnylgvmqslielqeqcqlfvfvadlhsitvdfqpqalkqnnf
    dlvrtllavgldpqkaclflqsdllehsmmgylmmvqsnlgelqrmtqfkakkaeqtrnp
    ngtlniptglltypalmagdillyqpdivpvgndqkqhleltrdlaqriqkkfklklrlp
    qfvqnkdtnrimdlfdptkkmskssknqngviylddpkevvvkkirqattdsfnkirfas
    ktqpgvtnmltilkallkepvnqsltnqlgndleayfstksyldlknalteatvnllvni
    qrkreqisreqvfnclqagknqaqatarttlalfydgfglgsqnik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yy5C (C:)
    ghmmkraltgiqasgkqhlgnylgvmqslielqeqcqlfvfvadlhsitvdfqpqalkqn
    nfdlvrtllavgldpqkaclflqsdllehsmmgylmmvqsnlgelqrmtqfkakkaeqtr
    npngtlniptglltypalmagdillyqpdivpvgndqkqhleltrdlaqriqkkfklklr
    lpqfvqnkdtnrimdlfdptkkmskssknqngviylddpkevvvkkirqattdsfnkirf
    asktqpgvtnmltilkallkepvnqsltnqlgndleayfstksyldlknalteatvnllv
    niqrkreqisreqvfnclqagknqaqatarttlalfydgfglgsqnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yy5C (C:)
    mkraltgiqasgkqhlgnylgvmqslielqeqcqlfvfvadlhsitvdfqpqalkqnnfd
    lvrtllavgldpqkaclflqsdllehsmmgylmmvqsnlgelqrmtqfkakkalniptgl
    ltypalmagdillyqpdivpvgndqkqhleltrdlaqriqkkfklklrlpqfvqnkdtnr
    imdlfdptkkmskssknqngviylddpkevvvkkirqattdsfnkirfasktqpgvtnml
    tilkallkepvnqsltnqlgndleayfstksyldlknalteatvnllvniqrkreqisre
    qvfnclqagknqaqatarttlalfydgfglgsqnik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yy5D (D:)
    ghmmkraltgiqasgkqhlgnylgvmqslielqeqcqlfvfvadlhsitvdfqpqalkqn
    nfdlvrtllavgldpqkaclflqsdllehsmmgylmmvqsnlgelqrmtqfkakkaeqtr
    npngtlniptglltypalmagdillyqpdivpvgndqkqhleltrdlaqriqkkfklklr
    lpqfvqnkdtnrimdlfdptkkmskssknqngviylddpkevvvkkirqattdsfnkirf
    asktqpgvtnmltilkallkepvnqsltnqlgndleayfstksyldlknalteatvnllv
    niqrkreqisreqvfnclqagknqaqatarttlalfydgfglgsqnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yy5D (D:)
    mmkraltgiqasgkqhlgnylgvmqslielqeqcqlfvfvadlhsitvdfqpqalkqnnf
    dlvrtllavgldpqkaclflqsdllehsmmgylmmvqsnlgelqrmtqfkakkaeqtrnp
    ngtlniptglltypalmagdillyqpdivpvgndqkqhleltrdlaqriqkkfklklrlp
    qfvqnkdtnrimdlfdptkkmskssknqngviylddpkevvvkkirqattdsfnkirfas
    ktqpgvtnmltilkallkepvnqsltnqlgndleayfstksyldlknalteatvnllvni
    qrkreqisreqvfnclqagknqaqatarttlalfydgfglgsqnik