PDB entry 2yy3

View 2yy3 on RCSB PDB site
Description: Crystal Structure of translation elongation factor EF-1 beta from Pyrococcus horikoshii
Deposited on 2007-04-27, released 2007-10-30
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.236
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor 1-beta
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: elongation factor 1-beta
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: elongation factor 1-beta
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2yy3A (A:)
msdfnlvgvirvmptdpdvnldeleeklkkvipekyglakverepiafglvalkfyvlgr
deegysfdevaekfeevenvesaevetvsri

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2yy3B (B:)
msdfnlvgvirvmptdpdvnldeleeklkkvipekyglakverepiafglvalkfyvlgr
deegysfdevaekfeevenvesaevetvsri

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >2yy3C (C:)
msdfnlvgvirvmptdpdvnldeleeklkkvipekyglakverepiafglvalkfyvlgr
deegysfdevaekfeevenvesaevetvsri